Structure of PDB 8sst Chain A Binding Site BS02

Receptor Information
>8sst Chain A (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLN
THTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVS
TLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHA
RFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sst Structures of CTCF-DNA complexes including all 11 zinc fingers.
Resolution2.19 Å
Binding residue
(original residue number in PDB)		Y273 R277 R283 H284 R292 R301 F303 R304 H312 F331 E336 R339 H340 Y343 K344 Y358 E362 R368 H369 S372 R377 Y386 R389 K393 R396 H397 T400 K405 F416 T417 Q418 T421 H425 K429 R448 D451
Binding residue
(residue number reindexed from 1)		Y9 R13 R19 H20 R28 R37 F39 R40 H48 F67 E72 R75 H76 Y79 K80 Y94 E98 R104 H105 S108 R113 Y122 R125 K129 R132 H133 T136 K141 F152 T153 Q154 T157 H161 K165 R184 D187
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8sst, PDBe:8sst, PDBj:8sst
PDBsum8sst
PubMed37439339
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]