Structure of PDB 8sh1 Chain A Binding Site BS02

Receptor Information
>8sh1 Chain A (length=293) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNV
KLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLT
FEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCD
VQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTRTPFPSWRVLIQDLVLEG
DLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLRIYSLHTKLQSMNSEN
QTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8sh1 Human POT1 protects the telomeric ds-ss DNA junction by capping the 5' end of the chromosome.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y9 H82 R83 A102 S120 K121 Y122
Binding residue
(residue number reindexed from 1)		Y4 H77 R78 A97 S115 K116 Y117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043047 single-stranded telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
Cellular Component
GO:0000781 chromosome, telomeric region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8sh1, PDBe:8sh1, PDBj:8sh1
PDBsum8sh1
PubMed37590346
UniProtQ9NUX5|POTE1_HUMAN Protection of telomeres protein 1 (Gene Name=POT1)

[Back to BioLiP]