Structure of PDB 8rm6 Chain A Binding Site BS02

Receptor Information
>8rm6 Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKTCLICGDEASGAHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDK
FRRKNCPSCRLRKCYEAGMTLGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rm6 Structural mechanism underlying variations in DNA binding by the androgen receptor.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		G568 A569 H570 Y571 K580 K584
Binding residue
(residue number reindexed from 1)		G13 A14 H15 Y16 K25 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8rm6, PDBe:8rm6, PDBj:8rm6
PDBsum8rm6
PubMed38604378
UniProtP10275|ANDR_HUMAN Androgen receptor (Gene Name=AR)

[Back to BioLiP]