Structure of PDB 8q9n Chain A Binding Site BS02

Receptor Information
>8q9n Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q9n Folding of Class IIa HDAC Derived Peptides into alpha-helices Upon Binding to Myocyte Enhancer Factor-2 in Complex with DNA.
Resolution1.51 Å
Binding residue
(original residue number in PDB)
G2 R3 I6 K23 R24 K30
Binding residue
(residue number reindexed from 1)
G1 R2 I5 K22 R23 K29
External links