Structure of PDB 8pnt Chain A Binding Site BS02

Receptor Information
>8pnt Chain A (length=749) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTV
ARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAV
YLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLS
SLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQ
EEYLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPP
HTEDSVYPMPRVIFRMFDYTDDPEGPVMPGSHSVERFVIEENLHCIIKSH
WKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELFQLPAPPHIDVMYTTL
LIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHHLSNFQ
FRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSA
LCPANPTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVP
NPNSFNPLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKL
HVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTR
LFVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDRKDGVLEEQ
IERLQEKVESAQSEQKNLFLVIFQRFIMILTEHLVRCETDGTSVLTPWYK
NCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILAVFQQFCALQA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pnt Structural basis for competitive binding of productive and degradative co-transcriptional effectors to the nuclear cap-binding complex.
Resolution3.46 Å
Binding residue
(original residue number in PDB)		H570 R610 T611 Q612 H651
Binding residue
(residue number reindexed from 1)		H536 R576 T577 Q578 H617
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0000340 RNA 7-methylguanosine cap binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0060090 molecular adaptor activity
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000245 spliceosomal complex assembly
GO:0000380 alternative mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0002191 cap-dependent translational initiation
GO:0006370 7-methylguanosine mRNA capping
GO:0006401 RNA catabolic process
GO:0006406 mRNA export from nucleus
GO:0006408 snRNA export from nucleus
GO:0006417 regulation of translation
GO:0006446 regulation of translational initiation
GO:0008334 histone mRNA metabolic process
GO:0008380 RNA splicing
GO:0016070 RNA metabolic process
GO:0016071 mRNA metabolic process
GO:0030307 positive regulation of cell growth
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031053 primary miRNA processing
GO:0031124 mRNA 3'-end processing
GO:0031442 positive regulation of mRNA 3'-end processing
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035195 miRNA-mediated post-transcriptional gene silencing
GO:0042789 mRNA transcription by RNA polymerase II
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:0050684 regulation of mRNA processing
GO:0051028 mRNA transport
GO:0051607 defense response to virus
GO:1905216 positive regulation of RNA binding
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005846 nuclear cap binding complex
GO:0034518 RNA cap binding complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pnt, PDBe:8pnt, PDBj:8pnt
PDBsum8pnt
PubMed38175753
UniProtQ09161|NCBP1_HUMAN Nuclear cap-binding protein subunit 1 (Gene Name=NCBP1)

[Back to BioLiP]