Structure of PDB 8pnc Chain A Binding Site BS02

Receptor Information
>8pnc Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQ
NRRTKWKRQTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pnc Transcription factor BARHL2 bound to different DNA sequences
Resolution2.05 Å
Binding residue
(original residue number in PDB)		R233 R236 Y256 R262 K277 Q281 R284 K288
Binding residue
(residue number reindexed from 1)		R2 R5 Y25 R31 K46 Q50 R53 K57
External links
PDB RCSB:8pnc, PDBe:8pnc, PDBj:8pnc
PDBsum8pnc
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]