Structure of PDB 8pna Chain A Binding Site BS02

Receptor Information
>8pna Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQV
KTWYQNRRTKWKRQTAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pna transcription factor BARHL2 bound to different DNA sequences
Resolution1.45 Å
Binding residue
(original residue number in PDB)		R228 R233 R236 Y256 R262 K277 Q281 R284 K288
Binding residue
(residue number reindexed from 1)		R2 R7 R10 Y30 R36 K51 Q55 R58 K62
External links
PDB RCSB:8pna, PDBe:8pna, PDBj:8pna
PDBsum8pna
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]