Structure of PDB 8pmf Chain A Binding Site BS02

Receptor Information
>8pmf Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVK
TWYQNRRTKWKRQTAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pmf transcription factor BARHL2 bound to DNA sequences
Resolution0.95 Å
Binding residue
(original residue number in PDB)		R228 R236 Y256 R262 K277 Q281 R284 T285
Binding residue
(residue number reindexed from 1)		R1 R9 Y29 R35 K50 Q54 R57 T58
External links
PDB RCSB:8pmf, PDBe:8pmf, PDBj:8pmf
PDBsum8pmf
PubMed
UniProtQ9NY43|BARH2_HUMAN BarH-like 2 homeobox protein (Gene Name=BARHL2)

[Back to BioLiP]