Structure of PDB 8pi9 Chain A Binding Site BS02

Receptor Information
>8pi9 Chain A (length=165) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQS
HLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHARRNRFKWGPASQ
QILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTE
VRVYNWFANRRKEEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pi9 Molecular mechanism of HNF-1A-mediated HNF4A gene regulation and promoter-driven HNF4A-MODY diabetes.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N140 S142 H143 Q146 P153 M154 K155 K158 R203 F204 K205 W206 R263 N266 N270
Binding residue
(residue number reindexed from 1)		N48 S50 H51 Q54 P61 M62 K63 K66 R92 F93 K94 W95 R152 N155 N159
External links
PDB RCSB:8pi9, PDBe:8pi9, PDBj:8pi9
PDBsum8pi9
PubMed38855865
UniProtP20823|HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha (Gene Name=HNF1A)

[Back to BioLiP]