Structure of PDB 8pi8 Chain A Binding Site BS02

Receptor Information
>8pi8 Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVV
DTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGRRN
RFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQ
GLGSNLVTEVRVYNWFANRRKEEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pi8 Molecular mechanism of HNF-1A-mediated HNF4A gene regulation and promoter-driven HNF4A-MODY diabetes.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N140 S142 H143 P153 M154 K155 K158 R203 K205 W206 R263 N270
Binding residue
(residue number reindexed from 1)		N56 S58 H59 P69 M70 K71 K74 R101 K103 W104 R161 N168
External links
PDB RCSB:8pi8, PDBe:8pi8, PDBj:8pi8
PDBsum8pi8
PubMed38855865
UniProtP20823|HNF1A_HUMAN Hepatocyte nuclear factor 1-alpha (Gene Name=HNF1A)

[Back to BioLiP]