Structure of PDB 8ovw Chain A Binding Site BS02

Receptor Information
>8ovw Chain A (length=101) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQRKDSHKEVERRRRENINTAINVLSDLLPVRESSKAAILACAAEYIQKL
KETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMKRVL
R
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ovw Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		H227 K228 R235 N239 S255 K256
Binding residue
(residue number reindexed from 1)		H7 K8 R15 N19 S35 K36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0019237 centromeric DNA binding
GO:0046983 protein dimerization activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006338 chromatin remodeling
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007059 chromosome segregation
GO:0042762 regulation of sulfur metabolic process
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0061431 cellular response to methionine
GO:1900059 positive regulation of sulfate assimilation
GO:1900060 negative regulation of ceramide biosynthetic process
GO:1900090 positive regulation of inositol biosynthetic process
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005739 mitochondrion
GO:0089713 Cbf1-Met4-Met28 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovw, PDBe:8ovw, PDBj:8ovw
PDBsum8ovw
PubMed37506202
UniProtP17106|CBF1_YEAST Centromere-binding protein 1 (Gene Name=CBF1)

[Back to BioLiP]