Structure of PDB 8osb Chain A Binding Site BS02

Receptor Information
>8osb Chain A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVI
LSLEQQVRER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8osb DNA-guided transcription factor cooperativity shapes face and limb mesenchyme.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
R566 N570 E573 R574 T602
Binding residue
(residue number reindexed from 1)
R2 N6 E9 R10 T38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8osb, PDBe:8osb, PDBj:8osb
PDBsum8osb
PubMed38262408
UniProtP15884|ITF2_HUMAN Transcription factor 4 (Gene Name=TCF4)

[Back to BioLiP]