Structure of PDB 8oqg Chain A Binding Site BS02

Receptor Information

>8oqg Chain A (length=124) Species: 9913 (Bos taurus)

KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES
LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT
QANKHIIVACEGNPYVPVHFDASV

Ligand information

• Ligand ID: VW5
• InChI: InChI=1S/8H2O.2Rh/h8*1H2;;/q;;;;;;;;2*+6/p-8
• InChIKey: YTPCCBWWPVGKDX-UHFFFAOYSA-F
• SMILES:
  CACTVS 3.385: O[Rh++](O)(O)(O)[Rh++](O)(O)(O)O
  OpenEye OEToolkits 2.0.7: O[Rh+2](O)(O)(O)[Rh+2](O)(O)(O)O
• Formula: H8 O8 Rh2
• Name: dirhodium (II) oxide
• PDB chain: 8oqg Chain A Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8oqg Cross-Linked Crystals of Dirhodium Tetraacetate/RNase A Adduct Can Be Used as Heterogeneous Catalysts.
• Resolution: 1.6 Å
• Binding residue (original residue number in PDB): K7 H119
• Binding residue (residue number reindexed from 1): K7 H119
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 4.6.1.18: pancreatic ribonuclease.

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004522 ribonuclease A activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0016829 lyase activity

Biological Process

• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:8oqg, PDBe:8oqg, PDBj:8oqg
• PDBsum: 8oqg
• PubMed: 37144589
• UniProt: P61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)