Structure of PDB 8oqd Chain A Binding Site BS02

Receptor Information

>8oqd Chain A (length=124) Species: 9913 (Bos taurus)

KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES
LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT
QANKHIIVACEGNPYVPVHFDASV

Ligand information

• Ligand ID: VVU
• InChI: InChI=1S/4C2H4O2.2Rh/c4*1-2(3)4;;/h4*2H,1H3;;/q4*-2;2*+6
• InChIKey: XPFNQDMGXDTTDF-UHFFFAOYSA-N
• SMILES:
  OpenEye OEToolkits 2.0.7: CC1O[Rh+2]234OC(O[Rh+2]2(O1)(OC(O3)C)OC(O4)C)C
  CACTVS 3.385: C[CH]1O[Rh++]234O[CH](C)O[Rh++]2(O1)(O[CH](C)O3)O[CH](C)O4
  CACTVS 3.385: C[C@H]1O[Rh++]234O[C@H](C)O[Rh++]2(O1)(O[C@H](C)O3)O[C@@H](C)O4
• Formula: C8 H16 O8 Rh2
• Name: dirhodium (II) tetraacetate;
  Rhodium(II) acetate
• PDB chain: 8oqd Chain A Residue 205

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8oqd Cross-Linked Crystals of Dirhodium Tetraacetate/RNase A Adduct Can Be Used as Heterogeneous Catalysts.
• Resolution: 1.54 Å
• Binding residue (original residue number in PDB): T78 H105
• Binding residue (residue number reindexed from 1): T78 H105
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 4.6.1.18: pancreatic ribonuclease.

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004522 ribonuclease A activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0016829 lyase activity

Biological Process

• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:8oqd, PDBe:8oqd, PDBj:8oqd
• PDBsum: 8oqd
• PubMed: 37144589
• UniProt: P61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)