Structure of PDB 8kfu Chain A Binding Site BS02

Receptor Information
>8kfu Chain A (length=163) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPKDDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kfu MOC1 cleaves Holliday junctions through a cooperative nick and counter-nick mechanism mediated by metal ions.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		E174 K175 S177 P178 F179 P180 D182 W187 A212 Q214 K217 M223 R224
Binding residue
(residue number reindexed from 1)		E66 K67 S69 P70 F71 P72 D74 W79 A104 Q106 K109 M115 R116
External links