Structure of PDB 8jca Chain A Binding Site BS02

Receptor Information

>8jca Chain A (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTI
KIWDIGGLPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDK
PQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEK
DNIDITLQWLIQHS

Ligand information

Ligand ID

InChI

InChI=1S/Mg/q+2

InChIKey

JLVVSXFLKOJNIY-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Mg+2]
CACTVS 3.341	[Mg++]

Formula

Name

MAGNESIUM ION

PDB chain

8jca Chain A Residue 202 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8jca Mechanistic Insights into the Interactions of Arl8b with the RUN Domains of PLEKHM1 and SKIP.
Resolution	1.65 Å
Binding residue (original residue number in PDB)	T34 T52
Binding residue (residue number reindexed from 1)	T17 T35
Annotation score	1

Enzymatic activity

Enzyme Commision number

3.6.5.2: small monomeric GTPase.

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0043014	alpha-tubulin binding
GO:0048487	beta-tubulin binding

	Biological Process
GO:0001778	plasma membrane repair
GO:0002505	antigen processing and presentation of polysaccharide antigen via MHC class II
GO:0002747	antigen processing and presentation following phagocytosis
GO:0007059	chromosome segregation
GO:0008089	anterograde axonal transport
GO:0015031	protein transport
GO:0016197	endosomal transport
GO:0032418	lysosome localization
GO:0034498	early endosome to Golgi transport
GO:0042267	natural killer cell mediated cytotoxicity
GO:0046754	viral exocytosis
GO:0051301	cell division
GO:0061909	autophagosome-lysosome fusion
GO:0090117	endosome to lysosome transport of low-density lipoprotein particle
GO:0090385	phagosome-lysosome fusion
GO:1902774	late endosome to lysosome transport
GO:1902946	protein localization to early endosome
GO:1990927	calcium ion regulated lysosome exocytosis

	Cellular Component
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005819	spindle
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0016020	membrane
GO:0030424	axon
GO:0030496	midbody
GO:0031901	early endosome membrane
GO:0031902	late endosome membrane
GO:0042995	cell projection
GO:0045202	synapse
GO:0051233	spindle midzone
GO:0070062	extracellular exosome
GO:0101004	cytolytic granule membrane
GO:1904115	axon cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jca, PDBe:8jca, PDBj:8jca
PDBsum	8jca
PubMed	37775038
UniProt	Q9NVJ2\|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B (Gene Name=ARL8B)

[Back to BioLiP]