Structure of PDB 8ik8 Chain A Binding Site BS02

Receptor Information
>8ik8 Chain A (length=158) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWF
AFLGEGQEASNGIYPVIFYYKDFDELVLAYGISDTNEPHAQWQFSSDIPK
TIAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKL
IFNSGKSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ik8 Structural basis of target recognition by the DNA binding domain of McrBC
Resolution1.8 Å
Binding residue
(original residue number in PDB)
S20 Q21 S22 K24 Y41 G42 N43
Binding residue
(residue number reindexed from 1)
S20 Q21 S22 K24 Y41 G42 N43
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:8ik8, PDBe:8ik8, PDBj:8ik8
PDBsum8ik8
PubMed
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]