Structure of PDB 8htx Chain A Binding Site BS02

Receptor Information
>8htx Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLD
YLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGITESDWYRI
KQSIDSKCRTAWRRKQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8htx Structural insights into DNA recognition by the BEN domain of the transcription factor BANP.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N269 S271 G274 K275 H276 K278 R316
Binding residue
(residue number reindexed from 1)		N62 S64 G67 K68 H69 K71 R109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:8htx, PDBe:8htx, PDBj:8htx
PDBsum8htx
PubMed37086783
UniProtQ8N9N5|BANP_HUMAN Protein BANP (Gene Name=BANP)

[Back to BioLiP]