Structure of PDB 8hml Chain A Binding Site BS02

Receptor Information
>8hml Chain A (length=98) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGMLTVGDLVIEESTYTARLKGRALELTYKEFELLKYLAQHAGRVFTRA
QLLQEVWGYGGTRTVDVHVRRLRAKLGPEYDSMIGTVRNVGYKFVRPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hml Structural insights into the transcription activation mechanism of the global regulator GlnR from actinobacteria.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		R169 R186 D189 V190 R193 T209 N212 Y215
Binding residue
(residue number reindexed from 1)		R49 R63 D66 V67 R70 T86 N89 Y92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8hml, PDBe:8hml, PDBj:8hml
PDBsum8hml
PubMed37216560
UniProtA4FQD5

[Back to BioLiP]