Structure of PDB 8hcm Chain A Binding Site BS02

Receptor Information
>8hcm Chain A (length=100) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QCRLRPWLEEQIQSGRYPGVQWLDQSARVFQIPWKHAARHGWNIDKDATL
FRNWAIHTGRYKPGIDKPDPKTWKANFRCALNSLTDVKELQDAFRVYALL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hcm Structure of Danio rerio IRF10 and IRF11 bound DNA reveal determinants of interferon regulation
Resolution2.59 Å
Binding residue
(original residue number in PDB)		R3 L4 H36 A38 R39 T58 R60 N76 C79 A80 S83
Binding residue
(residue number reindexed from 1)		R3 L4 H36 A38 R39 T58 R60 N76 C79 A80 S83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8hcm, PDBe:8hcm, PDBj:8hcm
PDBsum8hcm
PubMed39058321
UniProtQ1RLP9

[Back to BioLiP]