Structure of PDB 8h69 Chain A Binding Site BS02

Receptor Information

>8h69 Chain A (length=716) Species: 93838 (Influenza A virus (A/goose/Guangdong/1/1996(H5N1)))

MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSD
FHFIDERGESTIIESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGV
EKPKFLPDLYDYKENRFIEIGVTRREVHTYYLEKANKIKSEKTHIHIFSF
TGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEET
IEERFEITGTMCRLADQSLPPNFSSLEKFRAYVDGFEPNGCIEGKLSQMS
KEVNARIEPFLKTTPRPLRLPDGPPCSQRSKFLLMDALKLSIEDPSHEGE
GIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNYLLAWKQVLAELQDIEN
EEKIPKTKNMRKTSQLKWALGENMAPEKVDFEDCKDVSDLRQYDSDEPKP
RSLASWIQSEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV
SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNL
YGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLL
RTAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
SVKEKDMTKEFFENKSETWPIGESPKGMEEGSIGKVCRTLLAKSVFNSLY
ASPQLEGFSAESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWV
LLNASWFNSFLTHALK

Ligand information

>8h69 Chain 5 (length=19)

aguagaaacaaggaguuuu

.<<....>>..........

Receptor-Ligand Complex Structure

Structure summary

Jmol._Canvas2D (Jmol) "jmolApplet0"[x]

loadScript jsmol/j2s/core/corebio.z.js

JSmol exec jmolApplet1 start applet null

Jmol JavaScript applet jmolApplet1__534904004420921__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet1__534904004420921__)

vwrOptions:

{ "name":"jmolApplet1","applet":true,"documentBase":"https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS02&chain=A&pdb=8h69","platform":"J.awtjs2d.Platform","fullName":"jmolApplet1__534904004420921__","codePath":"https://zhanglab.comp.nus.edu.sg/BioLiP/jsmol/j2s/","display":"jmolApplet1_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"534904004420921","bgcolor":"#FFFFFF" }

setting document base to "https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS02&chain=A&pdb=8h69"

(C) 2015 Jmol Development

Jmol Version: 14.32.79 2022-10-26 15:52

java.vendor: Java2Script (HTML5)

java.version: 2022-06-24 05:54:49 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet1 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor #FFFFFF

backgroundColor = "#FFFFFF"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

StatusManager callback set for APPLETREADYCallback f=Jmol._readyCallback cb=APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue MODELKITCallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SELECTCallback null

Jmol getValue SERVICECallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue SYNCCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet1__534904004420921__ ready

Jmol._Canvas2D (Jmol) "jmolApplet1"[x]

loadScript jsmol/j2s/core/package.js

loadScript jsmol/j2s/core/corejmol.z.js

loadScript jsmol/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__534904004420921__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__534904004420921__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS02&chain=A&pdb=8h69","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__534904004420921__","codePath":"https://zhanglab.comp.nus.edu.sg/BioLiP/jsmol/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"534904004420921","bgcolor":"#FFFFFF" }

setting document base to "https://zhanglab.comp.nus.edu.sg/BioLiP/pdb.cgi?bs=BS02&chain=A&pdb=8h69"

(C) 2015 Jmol Development

Jmol Version: 14.32.79 2022-10-26 15:52

java.vendor: Java2Script (HTML5)

java.version: 2022-06-24 05:54:49 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor #FFFFFF

backgroundColor = "#FFFFFF"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

StatusManager callback set for APPLETREADYCallback f=Jmol._readyCallback cb=APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue MODELKITCallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SELECTCallback null

Jmol getValue SERVICECallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue SYNCCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__534904004420921__ ready

script 1 started

script 1 started

• PDB: 8h69 An intermediate state allows influenza polymerase to switch smoothly between transcription and replication cycles.
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): H326 K328 G371 N373 M374 A375 P376 K378 Y393 D394 S395 E397 P398 R508 H510 R512 D516 V517 N519 K539 R566 T567 N568 G569 P653 N696
• Binding residue (residue number reindexed from 1): H326 K328 G371 N373 M374 A375 P376 K378 Y393 D394 S395 E397 P398 R508 H510 R512 D516 V517 N519 K539 R566 T567 N568 G569 P653 N696

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0005515 protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0039523 symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity
• GO:0039694 viral RNA genome replication
• GO:0075523 viral translational frameshifting
• GO:0075526 cap snatching

Cellular Component

• GO:0030430 host cell cytoplasm
• GO:0042025 host cell nucleus

External links

• PDB: RCSB:8h69, PDBe:8h69, PDBj:8h69
• PDBsum: 8h69
• PubMed: 37488357
• UniProt: Q9Q0U9|PA_I96A0 Polymerase acidic protein (Gene Name=PA)

Application loaded.