Structure of PDB 8h0l Chain A Binding Site BS02

Receptor Information
>8h0l Chain A (length=152) Species: 286420 (Hahella ganghwensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSLLEYEAKFSELNPNRRHGNTSPHKIAMLLAVMDLIESGSLQENRIYFD
RQLKDAFTKRFNELKSEADRDNPHLPYYHLHTSGFWHHQVNPGQRESYKT
MSASGASAIDQHIAYAYLDEELFELLQNFTVRKLLTSALDRNFAITETSR
KS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h0l Characterization of a promiscuous DNA sulfur binding domain and application in site-directed RNA base editing.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		P15 N16 H25 K26 D69 R70 L75 P76 H79 T82
Binding residue
(residue number reindexed from 1)		P15 N16 H25 K26 D69 R70 L75 P76 H79 T82
External links