Structure of PDB 8g6h Chain A Binding Site BS02

Receptor Information
>8g6h Chain A (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>8g6h Chain J (length=157) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccggcaatcgatgtatatatctgacacgtgcctggagactagggagtaat
ccccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcgg
tgctagagctgtctacgaccaattgagcggcctcggcaccgggattctga
tgggcgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g6h Ubiquitinated H2B as gatekeeper of the nucleosome acidic patch
Resolution3.06 Å
Binding residue
(original residue number in PDB)		R40 Y41 P43 G44 L65 R69
Binding residue
(residue number reindexed from 1)		R3 Y4 P6 G7 L28 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8g6h, PDBe:8g6h, PDBj:8g6h
PDBsum8g6h
PubMed39149911
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]