Structure of PDB 8g1w Chain A Binding Site BS02

Receptor Information

>8g1w Chain A (length=240) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGF
RYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIAL
LELEKPAEYSSMVRPISLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQ
KGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVED
GRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Ligand information

>8g1w Chain L (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YWK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8g1w Crystal Structure Matriptase (C731S) in Complex with Inhibitor VD4162B
Resolution	1.2 Å
Binding residue (original residue number in PDB)	F708 Q783 Q802 W826 G827 D828
Binding residue (residue number reindexed from 1)	F94 Q169 Q188 W211 G212 D213

Enzymatic activity

Enzyme Commision number

3.4.21.109: matriptase.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8g1w, PDBe:8g1w, PDBj:8g1w
PDBsum	8g1w
PubMed	38477709
UniProt	Q9Y5Y6\|ST14_HUMAN Suppressor of tumorigenicity 14 protein (Gene Name=ST14)

[Back to BioLiP]