Structure of PDB 8fe5 Chain A Binding Site BS02

Receptor Information

>8fe5 Chain A (length=404) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAY
DVLSDPRKREIFDRYGEEVKEFLAKAKEDFLKKWESPAQNTAHLDQFERI
KTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQ
AVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFY
AAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW
TLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQI
YEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKW
FATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKE
FSEF

Ligand information

>8fe5 Chain J (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TTYADFIASGRTGRRNAIHD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8fe5 Discovery and Synthesis of a Naturally Derived Protein Kinase Inhibitor that Selectively Inhibits Distinct Classes of Serine/Threonine Kinases
Resolution	2.51 Å
Binding residue (original residue number in PDB)	R189 I190 S194
Binding residue (residue number reindexed from 1)	R188 I189 S193

Enzymatic activity

Enzyme Commision number

2.7.11.11: cAMP-dependent protein kinase.

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0004679	AMP-activated protein kinase activity
GO:0004691	cAMP-dependent protein kinase activity
GO:0004712	protein serine/threonine/tyrosine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0019901	protein kinase binding
GO:0019904	protein domain specific binding
GO:0030145	manganese ion binding
GO:0031625	ubiquitin protein ligase binding
GO:0034237	protein kinase A regulatory subunit binding
GO:0099103	channel activator activity
GO:0106310	protein serine kinase activity

	Biological Process
GO:0001707	mesoderm formation
GO:0001843	neural tube closure
GO:0002027	regulation of heart rate
GO:0003091	renal water homeostasis
GO:0006397	mRNA processing
GO:0006468	protein phosphorylation
GO:0006611	protein export from nucleus
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0010737	protein kinase A signaling
GO:0010881	regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
GO:0016241	regulation of macroautophagy
GO:0016310	phosphorylation
GO:0018105	peptidyl-serine phosphorylation
GO:0019221	cytokine-mediated signaling pathway
GO:0032024	positive regulation of insulin secretion
GO:0032703	negative regulation of interleukin-2 production
GO:0034380	high-density lipoprotein particle assembly
GO:0034605	cellular response to heat
GO:0035694	mitochondrial protein catabolic process
GO:0045542	positive regulation of cholesterol biosynthetic process
GO:0045667	regulation of osteoblast differentiation
GO:0045722	positive regulation of gluconeogenesis
GO:0045879	negative regulation of smoothened signaling pathway
GO:0046827	positive regulation of protein export from nucleus
GO:0048240	sperm capacitation
GO:0050804	modulation of chemical synaptic transmission
GO:0050850	positive regulation of calcium-mediated signaling
GO:0051726	regulation of cell cycle
GO:0055117	regulation of cardiac muscle contraction
GO:0061136	regulation of proteasomal protein catabolic process
GO:0070417	cellular response to cold
GO:0070613	regulation of protein processing
GO:0071333	cellular response to glucose stimulus
GO:0071374	cellular response to parathyroid hormone stimulus
GO:0071377	cellular response to glucagon stimulus
GO:0071872	cellular response to epinephrine stimulus
GO:0086064	cell communication by electrical coupling involved in cardiac conduction
GO:0099170	postsynaptic modulation of chemical synaptic transmission
GO:1903779	regulation of cardiac conduction
GO:1904262	negative regulation of TORC1 signaling
GO:1904539	negative regulation of glycolytic process through fructose-6-phosphate
GO:1990044	protein localization to lipid droplet
GO:2000810	regulation of bicellular tight junction assembly

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005930	axoneme
GO:0005952	cAMP-dependent protein kinase complex
GO:0016607	nuclear speck
GO:0031410	cytoplasmic vesicle
GO:0031514	motile cilium
GO:0031594	neuromuscular junction
GO:0034704	calcium channel complex
GO:0036126	sperm flagellum
GO:0044853	plasma membrane raft
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:0097546	ciliary base
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fe5, PDBe:8fe5, PDBj:8fe5
PDBsum	8fe5
PubMed	37843072
UniProt	P17612\|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha (Gene Name=PRKACA); P25685\|DNJB1_HUMAN DnaJ homolog subfamily B member 1 (Gene Name=DNAJB1)

[Back to BioLiP]