Structure of PDB 8f6s Chain A Binding Site BS02

Receptor Information
>8f6s Chain A (length=665) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLW
LDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIK
PLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFR
KGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVP
KEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEK
HVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPP
RDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYL
SSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGY
SCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAV
LCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFW
DPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDD
VIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGN
DYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLRE
AGRIADQFLGAMYTL
Ligand information
Ligand IDXHX
InChIInChI=1S/C17H20N4OS/c1-10-20-21-17(23-10)19-16(22)12-5-2-4-11(8-12)14-9-15(14)18-13-6-3-7-13/h2,4-5,8,13-15,18H,3,6-7,9H2,1H3,(H,19,21,22)/t14-,15+/m1/s1
InChIKeyHQRYNOVKRKLADI-CABCVRRESA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 2.0.7Cc1nnc(s1)NC(=O)c2cccc(c2)C3CC3NC4CCC4
OpenEye OEToolkits 2.0.7Cc1nnc(s1)NC(=O)c2cccc(c2)[C@H]3C[C@@H]3NC4CCC4
CACTVS 3.385Cc1sc(NC(=O)c2cccc(c2)[CH]3C[CH]3NC4CCC4)nn1
ACDLabs 12.01Cc1nnc(NC(=O)c2cccc(c2)C2CC2NC2CCC2)s1
CACTVS 3.385Cc1sc(NC(=O)c2cccc(c2)[C@H]3C[C@@H]3NC4CCC4)nn1
FormulaC17 H20 N4 O S
Name3-[(1R,2S)-2-(cyclobutylamino)cyclopropyl]-N-(5-methyl-1,3,4-thiadiazol-2-yl)benzamide
ChEMBL
DrugBank
ZINC
PDB chain8f6s Chain A Residue 902 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f6s Distal drug resistance mutations promote covalent inhibitor-adduct Grob fragmentation in LSD1
Resolution2.91 Å
Binding residue
(original residue number in PDB)		A539 N540 D555
Binding residue
(residue number reindexed from 1)		A368 N369 D384
Annotation score1
Enzymatic activity
Enzyme Commision number 1.14.99.66: [histone-H3]-N(6),N(6)-dimethyl-L-lysine(4) FAD-dependent demethylase.
Gene Ontology
Molecular Function
GO:0002039 p53 binding
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0019899 enzyme binding
GO:0030374 nuclear receptor coactivator activity
GO:0032451 demethylase activity
GO:0032452 histone demethylase activity
GO:0032453 histone H3K4 demethylase activity
GO:0032454 histone H3K9 demethylase activity
GO:0042162 telomeric DNA binding
GO:0042802 identical protein binding
GO:0043426 MRF binding
GO:0050660 flavin adenine dinucleotide binding
GO:0050681 nuclear androgen receptor binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0061752 telomeric repeat-containing RNA binding
GO:0140297 DNA-binding transcription factor binding
GO:0140682 FAD-dependent H3K4me/H3K4me3 demethylase activity
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002052 positive regulation of neuroblast proliferation
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006482 protein demethylation
GO:0010569 regulation of double-strand break repair via homologous recombination
GO:0010718 positive regulation of epithelial to mesenchymal transition
GO:0010976 positive regulation of neuron projection development
GO:0014070 response to organic cyclic compound
GO:0021987 cerebral cortex development
GO:0031398 positive regulation of protein ubiquitination
GO:0032091 negative regulation of protein binding
GO:0032880 regulation of protein localization
GO:0034644 cellular response to UV
GO:0036211 protein modification process
GO:0042551 neuron maturation
GO:0043392 negative regulation of DNA binding
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0045793 positive regulation of cell size
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046098 guanine metabolic process
GO:0055001 muscle cell development
GO:0060765 regulation of androgen receptor signaling pathway
GO:0060992 response to fungicide
GO:0071320 cellular response to cAMP
GO:0071480 cellular response to gamma radiation
GO:0090308 regulation of DNA methylation-dependent heterochromatin formation
GO:0120162 positive regulation of cold-induced thermogenesis
GO:0140861 DNA repair-dependent chromatin remodeling
GO:1902166 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:2000179 positive regulation of neural precursor cell proliferation
GO:2000648 positive regulation of stem cell proliferation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005667 transcription regulator complex
GO:0005694 chromosome
GO:0032991 protein-containing complex
GO:1990391 DNA repair complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8f6s, PDBe:8f6s, PDBj:8f6s
PDBsum8f6s
PubMed
UniProtO60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A (Gene Name=KDM1A)

[Back to BioLiP]