Structure of PDB 8f2q Chain A Binding Site BS02

Receptor Information

>8f2q Chain A (length=425) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLI
PKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL
ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTL
ACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS
CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIV
TGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ
QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGI
IEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD
KIEALQRHENESVYKASLNLIEKYF

Ligand information

>8f2q Chain C (length=8) Species: 10798 (Human parvovirus B19) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CHAKKPRI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8f2q Importin alpha / beta-dependent nuclear transport of human parvovirus B19 nonstructural protein 1 is essential for viral replication.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	S105 F138 W142 N146 S149 G150 T155 Q181 W184 N188 D192 N228 W231 R238 W273 Y277
Binding residue (residue number reindexed from 1)	S34 F67 W71 N75 S78 G79 T84 Q110 W113 N117 D121 N157 W160 R167 W202 Y206

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0061608	nuclear import signal receptor activity

	Biological Process
GO:0006606	protein import into nucleus

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8f2q, PDBe:8f2q, PDBj:8f2q
PDBsum	8f2q
PubMed	36990397
UniProt	P52293\|IMA1_MOUSE Importin subunit alpha-1 (Gene Name=Kpna2)

[Back to BioLiP]