Structure of PDB 8ebx Chain A Binding Site BS02

Receptor Information
>8ebx Chain A (length=604) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLV
AIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDG
IMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRN
SEGEATETVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINID
LKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRK
RCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAIST
YSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQ
AHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAE
VWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKII
VFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISK
VGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRYNAFFYSLVSQDTQ
EMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLA
ATDL
Ligand information
>8ebx Chain M (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcacgtctattatcctcagcgcaatcagctgtgactacct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ebx Lesion recognition by XPC, TFIIH and XPA in DNA excision repair.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		T416 T445 A448 K449 M450 F451 R472 E473 K526 K528 H629 G631 Y672
Binding residue
(residue number reindexed from 1)		T307 T336 A339 K340 M341 F342 R363 E364 K417 K419 H520 G522 Y554
Enzymatic activity
Enzyme Commision number 5.6.2.4: DNA 3'-5' helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003684 damaged DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016853 isomerase activity
GO:0016887 ATP hydrolysis activity
GO:0043138 3'-5' DNA helicase activity
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000717 nucleotide-excision repair, DNA duplex unwinding
GO:0001666 response to hypoxia
GO:0006265 DNA topological change
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006289 nucleotide-excision repair
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0006915 apoptotic process
GO:0006979 response to oxidative stress
GO:0008104 protein localization
GO:0009411 response to UV
GO:0009650 UV protection
GO:0035315 hair cell differentiation
GO:0043065 positive regulation of apoptotic process
GO:0048568 embryonic organ development
GO:1901990 regulation of mitotic cell cycle phase transition
Cellular Component
GO:0000112 nucleotide-excision repair factor 3 complex
GO:0000439 transcription factor TFIIH core complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005675 transcription factor TFIIH holo complex
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ebx, PDBe:8ebx, PDBj:8ebx
PDBsum8ebx
PubMed37076618
UniProtP19447|ERCC3_HUMAN General transcription and DNA repair factor IIH helicase/translocase subunit XPB (Gene Name=ERCC3)

[Back to BioLiP]