Structure of PDB 8e5d Chain A Binding Site BS02

Receptor Information
>8e5d Chain A (length=136) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSYALGPYQISAPQLPAYNGQTVGTFYYVNDAGGLESKVFSSGGPTPYPN
YANAGHVAGQSALFMRDNGISEGLVFHNNPEGTCGFCVNMTETLLPENAK
MTVVPPEGAIPVKRGATGETKVFTGNSNSPKSPHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e5d Structural basis of sequence-specific cytosine deamination by double-stranded DNA deaminase toxin DddA.
Resolution2.39 Å
Binding residue
(original residue number in PDB)
A1341 H1345 F1375 R1403
Binding residue
(residue number reindexed from 1)
A52 H56 F86 R114
Enzymatic activity
Enzyme Commision number 3.5.4.-
External links
PDB RCSB:8e5d, PDBe:8e5d, PDBj:8e5d
PDBsum8e5d
PubMed37460895
UniProtP0DUH5|DDDA_BURC1 Double-stranded DNA deaminase toxin A (Gene Name=dddA)

[Back to BioLiP]