Structure of PDB 8e40 Chain A Binding Site BS02

Receptor Information
>8e40 Chain A (length=371) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEPMDPRTFVSNFNNRPILSGLDTVWLCCEVKTKDPSGPPLDAKIFQGKV
YPKAKYHPEMRFLRWFHKWRQLHHDQEYKVTWYVSWSPCTRCANSVATFL
AKDPKVTLTIFVARLYYFWDPDYQQALRILAEAGATMKIMNYNEFQDCWN
KFVDGRGKPFKPWNNLPKHYTLLQATLGELLRHLMDPGTFTSNFNNKPWV
SGQHETYLCYKVERLHNDTWVPLNQHRGFLRNQAPNIHGFPKGRHAQLCF
LDLIPFWKLDGQQYRVTCFTSWSPCFSCAQEMAKFISNNEHVSLCIFAAR
IYDDQGRYQEGLRTLHRDGAKIAMMNYSEFEYCWDTFVDRQGRPFQPWDG
LDEHSQALSGRLRAILQNQGN
Ligand information
>8e40 Chain r (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuaaaaaaaaaaaaaaaaa
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e40 Structural basis for HIV-1 antagonism of host APOBEC3G via Cullin E3 ligase.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		R24 P25 I26 L27 S28 Y59 W94 L123 Y124 Y125 F126 W127 N176 F268 K270
Binding residue
(residue number reindexed from 1)		R16 P17 I18 L19 S20 Y51 W86 L115 Y116 Y117 F118 W119 N164 F256 K258
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003824 catalytic activity
GO:0004126 cytidine deaminase activity
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0009972 cytidine deamination
GO:0010526 retrotransposon silencing
GO:0016554 cytidine to uridine editing
GO:0045087 innate immune response
GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
GO:0051607 defense response to virus
GO:0070383 DNA cytosine deamination
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e40, PDBe:8e40, PDBj:8e40
PDBsum8e40
PubMed36598981
UniProtQ7YR23|ABC3G_MACMU DNA dC->dU-editing enzyme APOBEC-3G (Gene Name=APOBEC3G)

[Back to BioLiP]