Structure of PDB 8e3d Chain A Binding Site BS02

Receptor Information
>8e3d Chain A (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMR
KHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8e3d Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.
Resolution2.62 Å
Binding residue
(original residue number in PDB)		K396 R402 Q422 K426 Y438 N450 K454 Y466 S478 D479 H482
Binding residue
(residue number reindexed from 1)		K16 R22 Q42 K46 Y58 N70 K74 Y86 S98 D99 H102
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8e3d, PDBe:8e3d, PDBj:8e3d
PDBsum8e3d
PubMed36626981
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]