Structure of PDB 8dwf Chain A Binding Site BS02

Receptor Information
>8dwf Chain A (length=352) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSSVMLQQTRVETVI
PYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTR
YGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLF
LVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSC
LLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRK
RDSTGLLANLWEFPSCETADGKEKLEQMVGEQYGLQVELTEPIVSFEHAF
SHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKE
WA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dwf Structural Basis for Base Engagement and Stereochemistry Revealed by Alteration of Catalytic Residue Glu43 in DNA Repair Glycosylase MutY
Resolution2.6 Å
Binding residue
(original residue number in PDB)
W30 L46 Q47 Q48 R50 V51 Y88 G122 G124 P125 Y126 T127 D144 G145 N146 R149 I191 K228
Binding residue
(residue number reindexed from 1)
W25 L41 Q42 Q43 R45 V46 Y83 G117 G119 P120 Y121 T122 D139 G140 N141 R144 I186 K223
Enzymatic activity
Enzyme Commision number 3.2.2.31: adenine glycosylase.
Gene Ontology
Molecular Function
GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0016798 hydrolase activity, acting on glycosyl bonds
GO:0019104 DNA N-glycosylase activity
GO:0032357 oxidized purine DNA binding
GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
GO:0035485 adenine/guanine mispair binding
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006298 mismatch repair
GO:0006950 response to stress

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8dwf, PDBe:8dwf, PDBj:8dwf
PDBsum8dwf
PubMed
UniProtP83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)

[Back to BioLiP]