Structure of PDB 8dw4 Chain A Binding Site BS02

Receptor Information

>8dw4 Chain A (length=348) Species: 1422 (Geobacillus stearothermophilus)

RFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIP
YFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRY
GGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGSVMRVLSRLFL
VTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCL
LCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKR
DSTGLLANLWEFPSCETDDGKEKLEQMVGEQVELTEPIVSFEHAFSHLVW
QLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS

Ligand information

>8dw4 Chain C (length=11)

tgtccacgtct

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8dw4 Structural snapshots of base excision by the cancer-associated variant MutY N146S reveal a retaining mechanism.
• Resolution: 2.49 Å
• Binding residue (original residue number in PDB): L46 Q47 Q48 R50 V51 G122 G124 Y126 T127 D144 G145 R149
• Binding residue (residue number reindexed from 1): L40 Q41 Q42 R44 V45 G116 G118 Y120 T121 D138 G139 R143

Enzymatic activity

• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Gene Ontology

Molecular Function

• GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0032357 oxidized purine DNA binding
• GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
• GO:0035485 adenine/guanine mispair binding
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006298 mismatch repair
• GO:0006950 response to stress

External links

• PDB: RCSB:8dw4, PDBe:8dw4, PDBj:8dw4
• PDBsum: 8dw4
• PubMed: 36631987
• UniProt: P83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)