Structure of PDB 8dtu Chain A Binding Site BS02

Receptor Information
>8dtu Chain A (length=113) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGGGLVQAGDSLRLSCAASGSTFSGYAMGWYRQAPGKERELVAAITSSGA
STYYADSVRGRFTISRDDAKNTVYLQMNSLKPEDTAVYYCAALDEGYLDY
DSWGQGTQVTVSS
Ligand information
>8dtu Chain C (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VYKCEICKMPFSVYSTLEKHMKKWHSDR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dtu Evolution of nanobodies specific for BCL11A.
Resolution2.447 Å
Binding residue
(original residue number in PDB)		Y37 L47 I51 T52 S53 S54 A56 S57 Y59 L99 D100 G102 Y103
Binding residue
(residue number reindexed from 1)		Y31 L41 I45 T46 S47 S48 A50 S51 Y53 L93 D94 G96 Y97
External links