Structure of PDB 8dlf Chain A Binding Site BS02

Receptor Information
>8dlf Chain A (length=160) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGV
FVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRES
IVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLP
PWFPPMVEGA
Ligand information
>8dlf Chain F (length=56) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gataggatagcctatgctacccagatataaattaggatagcatatactac
ccagat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dlf Cryo-EM Structure and Functional Studies of EBNA1 Binding to the Family of Repeats and Dyad Symmetry Elements of Epstein-Barr Virus oriP.
Resolution3.23 Å
Binding residue
(original residue number in PDB)		K460 K461 G462 G463 W464 F465 H468 R469 K477 S513 T515 S516 N519 L554 P587 T590
Binding residue
(residue number reindexed from 1)		K3 K4 G5 G6 W7 F8 H11 R12 K20 S56 T58 S59 N62 L97 P130 T133
Enzymatic activity
Enzyme Commision number 3.1.21.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dlf, PDBe:8dlf, PDBj:8dlf
PDBsum8dlf
PubMed36037477
UniProtP03211|EBNA1_EBVB9 Epstein-Barr nuclear antigen 1 (Gene Name=EBNA1)

[Back to BioLiP]