Structure of PDB 8cl0 Chain A Binding Site BS02

Receptor Information

>8cl0 Chain A (length=214) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQ
DLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHQMREPRGSDIAGT
TSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGP
KEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGP
GATLEEMMTACQGV

Ligand information

>8cl0 Chain H (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NSPSGVFTFGAN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cl0 Two structural switches in HIV-1 capsid regulate capsid curvature and host factor binding.
Resolution	3.12 Å
Binding residue (original residue number in PDB)	P34 I37 P38 N139 R143 R173 Q176
Binding residue (residue number reindexed from 1)	P34 I37 P38 N132 R136 R166 Q169

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:8cl0, PDBe:8cl0, PDBj:8cl0
PDBsum	8cl0
PubMed	37040417
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]