Structure of PDB 8cj2 Chain A Binding Site BS02

Receptor Information
>8cj2 Chain A (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cj2 Unexpected binding modes of inhibitors to the histone chaperone ASF1 revealed by a foldamer scanning approach.
Resolution2.127 Å
Binding residue
(original residue number in PDB)
V6 N7 V9 S142 P144 R145 V146 R148
Binding residue
(residue number reindexed from 1)
V6 N7 V9 S142 P144 R145 V146 R148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8cj2, PDBe:8cj2, PDBj:8cj2
PDBsum8cj2
PubMed37347155
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]