Structure of PDB 8cdn Chain A Binding Site BS02

Receptor Information

>8cdn Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELRVGLEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSF
LLDFVAADNHRWKYVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAP
VSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQRMITSHCFPET
QFIAVTAYQNEEITALKIKYNPFAKAFLDAK

Ligand information

>8cdn Chain D (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aggctcacacct

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8cdn Crystal structure of human Brachyury in complex with a single T box binding element DNA
Resolution	2.55 Å
Binding residue (original residue number in PDB)	K103 N150 S162 T196 A216
Binding residue (residue number reindexed from 1)	K63 N110 S122 T156 A176

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8cdn, PDBe:8cdn, PDBj:8cdn
PDBsum	8cdn
PubMed
UniProt	O15178\|TBXT_HUMAN T-box transcription factor T (Gene Name=TBXT)

[Back to BioLiP]