Structure of PDB 8c84 Chain A Binding Site BS02

Receptor Information
>8c84 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c84 Structural basis of myocyte enhancer factor-2 recruitment of class II histone deacetylases.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
G2 R3 K4 I6 K23 R24 K30
Binding residue
(residue number reindexed from 1)
G1 R2 K3 I5 K22 R23 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8c84, PDBe:8c84, PDBj:8c84
PDBsum8c84
PubMed38492719
UniProtQ14814|MEF2D_HUMAN Myocyte-specific enhancer factor 2D (Gene Name=MEF2D)

[Back to BioLiP]