Structure of PDB 8c7s Chain A Binding Site BS02

Receptor Information
>8c7s Chain A (length=256) Species: 367830 (Staphylococcus aureus subsp. aureus USA300) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILG
SSLNELLKSQRIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPP
ENRELFIDSRTTIFPILGGGERLGTLVLGRVHDDFNENDLVLGEYAATVI
GMEILREKHSEVEKEARDKAAITMAINSLSYSEKEAIEHIFEELGGTEGL
LIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGTFIKVKKEKFL
DELEKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c7s Structural insights into CodY activation and DNA recognition.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		I202 A203 S204 K205 S215 V218 R222 S234 G236 M237 G239 T240
Binding residue
(residue number reindexed from 1)		I202 A203 S204 K205 S215 V218 R222 S234 G236 M237 G239 T240
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005525 GTP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c7s, PDBe:8c7s, PDBj:8c7s
PDBsum8c7s
PubMed37326020
UniProtQ2FHI3|CODY_STAA3 Global transcriptional regulator CodY (Gene Name=codY)

[Back to BioLiP]