Structure of PDB 8c1p Chain A Binding Site BS02

Receptor Information
>8c1p Chain A (length=399) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRL
EIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFS
KPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFL
VSRFSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIII
SSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSK
IAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIE
QRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLK
SKWWYDKGECGSKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSR
Ligand information
Ligand IDGLU
InChIInChI=1S/C5H9NO4/c6-3(5(9)10)1-2-4(7)8/h3H,1-2,6H2,(H,7,8)(H,9,10)/t3-/m0/s1
InChIKeyWHUUTDBJXJRKMK-VKHMYHEASA-N
SMILES
SoftwareSMILES
ACDLabs 12.01O=C(O)C(N)CCC(=O)O
OpenEye OEToolkits 1.7.0C(CC(=O)O)C(C(=O)O)N
OpenEye OEToolkits 1.7.0C(CC(=O)O)[C@@H](C(=O)O)N
CACTVS 3.370N[C@@H](CCC(O)=O)C(O)=O
CACTVS 3.370N[CH](CCC(O)=O)C(O)=O
FormulaC5 H9 N O4
NameGLUTAMIC ACID
ChEMBLCHEMBL575060
DrugBankDB00142
ZINCZINC000001482113
PDB chain8c1p Chain A Residue 1404 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c1p Structural mobility tunes signalling of the GluA1 AMPA glutamate receptor.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y446 T476 R481 S650 T651 E701
Binding residue
(residue number reindexed from 1)		Y58 T88 R93 S241 T242 E292
Annotation score1
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001540 amyloid-beta binding
GO:0001965 G-protein alpha-subunit binding
GO:0004970 glutamate-gated receptor activity
GO:0004971 AMPA glutamate receptor activity
GO:0005216 monoatomic ion channel activity
GO:0005515 protein binding
GO:0008179 adenylate cyclase binding
GO:0015276 ligand-gated monoatomic ion channel activity
GO:0019865 immunoglobulin binding
GO:0019901 protein kinase binding
GO:0019904 protein domain specific binding
GO:0022849 glutamate-gated calcium ion channel activity
GO:0030165 PDZ domain binding
GO:0031267 small GTPase binding
GO:0031489 myosin V binding
GO:0031681 G-protein beta-subunit binding
GO:0031698 beta-2 adrenergic receptor binding
GO:0035254 glutamate receptor binding
GO:0038023 signaling receptor activity
GO:0042802 identical protein binding
GO:0051018 protein kinase A binding
GO:0051428 peptide hormone receptor binding
GO:0097110 scaffold protein binding
GO:0099507 ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0099583 neurotransmitter receptor activity involved in regulation of postsynaptic cytosolic calcium ion concentration
GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Biological Process
GO:0001919 regulation of receptor recycling
GO:0006811 monoatomic ion transport
GO:0007268 chemical synaptic transmission
GO:0007416 synapse assembly
GO:0007616 long-term memory
GO:0009410 response to xenobiotic stimulus
GO:0009636 response to toxic substance
GO:0009744 response to sucrose
GO:0010226 response to lithium ion
GO:0010628 positive regulation of gene expression
GO:0014070 response to organic cyclic compound
GO:0019228 neuronal action potential
GO:0019722 calcium-mediated signaling
GO:0021510 spinal cord development
GO:0021987 cerebral cortex development
GO:0031623 receptor internalization
GO:0031667 response to nutrient levels
GO:0032355 response to estradiol
GO:0034220 monoatomic ion transmembrane transport
GO:0034765 regulation of monoatomic ion transmembrane transport
GO:0035235 ionotropic glutamate receptor signaling pathway
GO:0035249 synaptic transmission, glutamatergic
GO:0042220 response to cocaine
GO:0043278 response to morphine
GO:0043434 response to peptide hormone
GO:0045471 response to ethanol
GO:0045838 positive regulation of membrane potential
GO:0046685 response to arsenic-containing substance
GO:0048167 regulation of synaptic plasticity
GO:0048266 behavioral response to pain
GO:0050804 modulation of chemical synaptic transmission
GO:0050806 positive regulation of synaptic transmission
GO:0051602 response to electrical stimulus
GO:0060078 regulation of postsynaptic membrane potential
GO:0060291 long-term synaptic potentiation
GO:0060292 long-term synaptic depression
GO:0060992 response to fungicide
GO:0071230 cellular response to amino acid stimulus
GO:0071242 cellular response to ammonium ion
GO:0071359 cellular response to dsRNA
GO:0071363 cellular response to growth factor stimulus
GO:0071375 cellular response to peptide hormone stimulus
GO:0071407 cellular response to organic cyclic compound
GO:0071418 cellular response to amine stimulus
GO:0090326 positive regulation of locomotion involved in locomotory behavior
GO:0099505 regulation of presynaptic membrane potential
GO:0099566 regulation of postsynaptic cytosolic calcium ion concentration
GO:1905232 cellular response to L-glutamate
GO:1990416 cellular response to brain-derived neurotrophic factor stimulus
GO:1990708 conditioned place preference
GO:1990911 response to psychosocial stress
GO:2000463 positive regulation of excitatory postsynaptic potential
Cellular Component
GO:0005768 endosome
GO:0005769 early endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0008021 synaptic vesicle
GO:0008328 ionotropic glutamate receptor complex
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030425 dendrite
GO:0030672 synaptic vesicle membrane
GO:0031594 neuromuscular junction
GO:0031901 early endosome membrane
GO:0032279 asymmetric synapse
GO:0032281 AMPA glutamate receptor complex
GO:0032590 dendrite membrane
GO:0032591 dendritic spine membrane
GO:0032809 neuronal cell body membrane
GO:0032991 protein-containing complex
GO:0036477 somatodendritic compartment
GO:0042734 presynaptic membrane
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043197 dendritic spine
GO:0043198 dendritic shaft
GO:0044297 cell body
GO:0044308 axonal spine
GO:0044309 neuron spine
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0048787 presynaptic active zone membrane
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0060076 excitatory synapse
GO:0097060 synaptic membrane
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098839 postsynaptic density membrane
GO:0098978 glutamatergic synapse
GO:0099092 postsynaptic density, intracellular component
GO:0099544 perisynaptic space
GO:1990635 proximal dendrite

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c1p, PDBe:8c1p, PDBj:8c1p
PDBsum8c1p
PubMed37704721
UniProtP19490|GRIA1_RAT Glutamate receptor 1 (Gene Name=Gria1)

[Back to BioLiP]