Structure of PDB 8bwf Chain A Binding Site BS02

Receptor Information
>8bwf Chain A (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEE
AANTMVNYYTSVTPVLRGQPIYIQFSNH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bwf Rationally designed stapled peptides allosterically inhibit PTBP1-RNA-binding.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
T71 G73
Binding residue
(residue number reindexed from 1)
T16 G18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8bwf, PDBe:8bwf, PDBj:8bwf
PDBsum8bwf
PubMed37564416
UniProtP26599|PTBP1_HUMAN Polypyrimidine tract-binding protein 1 (Gene Name=PTBP1)

[Back to BioLiP]