Structure of PDB 8amf Chain A Binding Site BS02

Receptor Information
>8amf Chain A (length=333) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEISKKFGAEREKALNDALKLIEKDFGKGSIMRLGERAEQKVQVMSSGSL
ALDIALGSGGYPKGRIIEIYGPESSGKTTVALHAVAQAQKEGGIAAFIDA
EHALDPAYAAALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDS
VAALVPRAEIDGDIGDSHVGLQARMMSQAMRKLGASINKTKTIAIFINQL
REKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVGKE
TKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWY
SYKDEKIGQGSENAKKYLAEHPEIFDEIDKQVR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8amf Assembly mechanism and cryoEM structure of RecA filaments from Streptococcus pneumoniae
Resolution3.8 Å
Binding residue
(original residue number in PDB)		G178 R182 V212 G225
Binding residue
(residue number reindexed from 1)		G170 R174 V204 G217
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0009432 SOS response
GO:0030420 establishment of competence for transformation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8amf, PDBe:8amf, PDBj:8amf
PDBsum8amf
PubMed36806960
UniProtP0A452|RECA_STRR6 Protein RecA (Gene Name=recA)

[Back to BioLiP]