Structure of PDB 8af0 Chain A Binding Site BS02

Receptor Information
>8af0 Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNK
RSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGF
RNVVVACENGLPVALDQSIFRRP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8af0 Structure of angiogenin dimer bound to double-stranded RNA.
Resolution2.43 Å
Binding residue
(original residue number in PDB)		R24 P91
Binding residue
(residue number reindexed from 1)		R24 P91
Enzymatic activity
Enzyme Commision number 3.1.27.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003779 actin binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0004549 tRNA-specific ribonuclease activity
GO:0005102 signaling receptor binding
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008201 heparin binding
GO:0019843 rRNA binding
GO:0042277 peptide binding
GO:0042803 protein homodimerization activity
GO:0043022 ribosome binding
Biological Process
GO:0001525 angiogenesis
GO:0001541 ovarian follicle development
GO:0001556 oocyte maturation
GO:0001666 response to hypoxia
GO:0001890 placenta development
GO:0001938 positive regulation of endothelial cell proliferation
GO:0007154 cell communication
GO:0009303 rRNA transcription
GO:0009725 response to hormone
GO:0016078 tRNA decay
GO:0016477 cell migration
GO:0017148 negative regulation of translation
GO:0019731 antibacterial humoral response
GO:0023052 signaling
GO:0030041 actin filament polymerization
GO:0030154 cell differentiation
GO:0032055 negative regulation of translation in response to stress
GO:0034063 stress granule assembly
GO:0042327 positive regulation of phosphorylation
GO:0042592 homeostatic process
GO:0043066 negative regulation of apoptotic process
GO:0045087 innate immune response
GO:0048662 negative regulation of smooth muscle cell proliferation
GO:0050714 positive regulation of protein secretion
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0071425 hematopoietic stem cell proliferation
Cellular Component
GO:0005576 extracellular region
GO:0005604 basement membrane
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0015629 actin cytoskeleton
GO:0030139 endocytic vesicle
GO:0030426 growth cone
GO:0031410 cytoplasmic vesicle
GO:0032311 angiogenin-PRI complex
GO:0043025 neuronal cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8af0, PDBe:8af0, PDBj:8af0
PDBsum8af0
PubMed36048083
UniProtP03950|ANGI_HUMAN Angiogenin (Gene Name=ANG)

[Back to BioLiP]