Structure of PDB 8aan Chain A Binding Site BS02

Receptor Information
>8aan Chain A (length=228) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSHDGI
CEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYYESFPWFIKPAH
SPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLC
QYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRT
PMRLSYIEKKKGRQTTHIVFSFRDITSM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8aan Rep protein accommodates together dsDNA and ssDNA which enables a loop-back mechanism to plasmid DNA replication initiation.
Resolution2.19 Å
Binding residue
(original residue number in PDB)		S75 S79 K80 R83 R124 G125 Y127 N159 P195 Q196 S197 Y198 D203 R207
Binding residue
(residue number reindexed from 1)		S66 S70 K71 R74 R104 G105 Y107 N139 P175 Q176 S177 Y178 D183 R187
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006276 plasmid maintenance
GO:0071897 DNA biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8aan, PDBe:8aan, PDBj:8aan
PDBsum8aan
PubMed37713613
UniProtP03856|REPE1_ECOLI Replication initiation protein (Gene Name=repE)

[Back to BioLiP]