Structure of PDB 8a8f Chain A Binding Site BS02

Receptor Information
>8a8f Chain A (length=295) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLE
LEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI
CLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTD
CFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDL
LWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDG
YEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPA
Ligand information
Ligand IDMN
InChIInChI=1S/Mn/q+2
InChIKeyWAEMQWOKJMHJLA-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mn+2]
CACTVS 3.341[Mn++]
FormulaMn
NameMANGANESE (II) ION
ChEMBL
DrugBankDB06757
ZINC
PDB chain8a8f Chain A Residue 402 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a8f Crystal structure of Glc7 phosphatase in complex with the regulatory region of Ref2
Resolution1.85 Å
Binding residue
(original residue number in PDB)		D91 N123 H172 H247
Binding residue
(residue number reindexed from 1)		D88 N120 H169 H244
Annotation score1
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0017018 myosin phosphatase activity
GO:0046872 metal ion binding
Biological Process
GO:0000076 DNA replication checkpoint signaling
GO:0000077 DNA damage checkpoint signaling
GO:0000282 cellular bud site selection
GO:0000723 telomere maintenance
GO:0005977 glycogen metabolic process
GO:0005979 regulation of glycogen biosynthetic process
GO:0006397 mRNA processing
GO:0006873 intracellular monoatomic ion homeostasis
GO:0006986 response to unfolded protein
GO:0007059 chromosome segregation
GO:0007094 mitotic spindle assembly checkpoint signaling
GO:0007116 regulation of cell budding
GO:0007346 regulation of mitotic cell cycle
GO:0008360 regulation of cell shape
GO:0009408 response to heat
GO:0030437 ascospore formation
GO:0030837 negative regulation of actin filament polymerization
GO:0030846 termination of RNA polymerase II transcription, poly(A)-coupled
GO:0031297 replication fork processing
GO:0031536 positive regulation of exit from mitosis
GO:0034501 protein localization to kinetochore
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051276 chromosome organization
GO:0051301 cell division
GO:0051321 meiotic cell cycle
GO:0051726 regulation of cell cycle
GO:0070873 regulation of glycogen metabolic process
GO:1901901 regulation of protein localization to cell division site involved in cytokinesis
GO:1903501 positive regulation of mitotic actomyosin contractile ring assembly
GO:1904547 regulation of cellular response to glucose starvation
GO:2000370 positive regulation of clathrin-dependent endocytosis
Cellular Component
GO:0000131 incipient cellular bud site
GO:0000164 protein phosphatase type 1 complex
GO:0000776 kinetochore
GO:0001400 mating projection base
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005816 spindle pole body
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:0005935 cellular bud neck
GO:0032153 cell division site
GO:0032174 cellular bud neck septin collar

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a8f, PDBe:8a8f, PDBj:8a8f
PDBsum8a8f
PubMed38029752
UniProtP32598|PP12_YEAST Serine/threonine-protein phosphatase PP1-2 (Gene Name=GLC7)

[Back to BioLiP]