Structure of PDB 7zlq Chain A Binding Site BS02

Receptor Information
>7zlq Chain A (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKV
GGRWFPAVCAHSKKQGKQEAADAALRVLIGEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zlq to be changed at publication stage
Resolution2.8 Å
Binding residue
(original residue number in PDB)
Y722 E733 R736
Binding residue
(residue number reindexed from 1)
Y8 E19 R22
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
External links
PDB RCSB:7zlq, PDBe:7zlq, PDBj:7zlq
PDBsum7zlq
PubMed
UniProtP55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]