Structure of PDB 7z5k Chain A Binding Site BS02

Receptor Information
>7z5k Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRY
IESLQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z5k Transcription factor MYF5 bound to non-symmetrical site
Resolution2.28 Å
Binding residue
(original residue number in PDB)		R85 T89 R93 P119 K120
Binding residue
(residue number reindexed from 1)		R5 T9 R13 P39 K40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007517 muscle organ development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7z5k, PDBe:7z5k, PDBj:7z5k
PDBsum7z5k
PubMed
UniProtP13349|MYF5_HUMAN Myogenic factor 5 (Gene Name=MYF5)

[Back to BioLiP]