Structure of PDB 7z0u Chain A Binding Site BS02

Receptor Information
>7z0u Chain A (length=78) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVSTVYVPTETSDTSLTVKDGFQWRKYGQKVTRDNPSPRAYFRCSFAPSC
PVKKKVQRSAEDPSLLVATYEGTHNHLG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z0u New aspects of DNA recognition by group II WRKY transcription factor revealed by structural and functional study of AtWRKY18 DNA binding domain.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		Y184 K187 T189 R190 R196 Y198 K210
Binding residue
(residue number reindexed from 1)		Y27 K30 T32 R33 R39 Y41 K53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7z0u, PDBe:7z0u, PDBj:7z0u
PDBsum7z0u
PubMed35660042
UniProtQ9C5T4|WRK18_ARATH WRKY transcription factor 18 (Gene Name=WRKY18)

[Back to BioLiP]