Structure of PDB 7yze Chain A Binding Site BS02

Receptor Information
>7yze Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQ
RWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yze Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1.
Resolution1.99 Å
Binding residue
(original residue number in PDB)		S163 Y164 R202 N205 S206 H209
Binding residue
(residue number reindexed from 1)		S12 Y13 R51 N54 S55 H58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yze, PDBe:7yze, PDBj:7yze
PDBsum7yze
PubMed36435807
UniProtQ9Y261|FOXA2_HUMAN Hepatocyte nuclear factor 3-beta (Gene Name=FOXA2)

[Back to BioLiP]